(data stored in ACNUC7421 zone)

EMBL: CP001509.YBDN

CP001509.YBDN        Location/Qualifiers
FT   CDS             complement(595825..596886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /locus_tag="ECD_00570"
FT                   /product="PAPS reductase-like domain protein"
FT                   /note="similar to b0602"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42448"
FT                   /protein_id="ACT42448.1"
FT                   /translation="MGKKICVLFIDWEAQFSCTINYVQSLRELYTDVIEEFYWVALPLT
FT                   TQNSLSQYQPEWQCWEPDVEWVRQPPQDAITDPDFFSFYQPGMTFEQFVREFAEWFSQK
FT                   RPAAMMIGIRADESYNRFVAIASLNKQRFADDKPWTTAAPGGHSWYIYPIYDWKVADIW
FT                   TWYANHQSLCNPLYNLMYQAGVPLRHMRICEPFGPEQRQGLWLYHVIEPDRWAAMCARV
FT                   SGVKSGGIYAGHDNHFYGHRKILKPEHLDWQEYALLLLNSMPEKTAEHYRNKIAIYLHW
FT                   YQKKGIEVPQTQQGDIGAKDIPSWRRICKVLLNNDYWCRALSFSPTKSKNYQRYNERIK
FT                   GKRQEWGILCNND"
     MGKKICVLFI DWEAQFSCTI NYVQSLRELY TDVIEEFYWV ALPLTTQNSL SQYQPEWQCW        60
     EPDVEWVRQP PQDAITDPDF FSFYQPGMTF EQFVREFAEW FSQKRPAAMM IGIRADESYN       120
     RFVAIASLNK QRFADDKPWT TAAPGGHSWY IYPIYDWKVA DIWTWYANHQ SLCNPLYNLM       180
     YQAGVPLRHM RICEPFGPEQ RQGLWLYHVI EPDRWAAMCA RVSGVKSGGI YAGHDNHFYG       240
     HRKILKPEHL DWQEYALLLL NSMPEKTAEH YRNKIAIYLH WYQKKGIEVP QTQQGDIGAK       300
     DIPSWRRICK VLLNNDYWCR ALSFSPTKSK NYQRYNERIK GKRQEWGILC NND              353
//

If you have problems or comments...

PBIL Back to PBIL home page