(data stored in ACNUC7421 zone)

EMBL: CP001509.YBER

CP001509.YBER        Location/Qualifiers
FT   CDS             637074..637781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybeR"
FT                   /locus_tag="ECD_00614"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0645"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42491"
FT                   /protein_id="ACT42491.1"
FT                   /translation="MDMESQKILFALSTPMEIRNECCLPSHSSPKMYLGTCFFDLSSSW
FT                   GIDDRDDLLRTIHRMIDNGHAARLAGFYHRWFRYSPCEWRDYLAELNEQGQAYAQFVAS
FT                   TAECCGEGGIKAWDYVRMGFLSRMGVLNNWLSEEESLWIQSRIHLRALRYYSNWRQYFA
FT                   GYTFGRQYWQSPEDDHLPLLREFLARKEYDDSGNDMFYQLFASDDAYYATLPWQPLADY
FT                   PTCPETLKDMSDL"
     MDMESQKILF ALSTPMEIRN ECCLPSHSSP KMYLGTCFFD LSSSWGIDDR DDLLRTIHRM        60
     IDNGHAARLA GFYHRWFRYS PCEWRDYLAE LNEQGQAYAQ FVASTAECCG EGGIKAWDYV       120
     RMGFLSRMGV LNNWLSEEES LWIQSRIHLR ALRYYSNWRQ YFAGYTFGRQ YWQSPEDDHL       180
     PLLREFLARK EYDDSGNDMF YQLFASDDAY YATLPWQPLA DYPTCPETLK DMSDL            235
//

If you have problems or comments...

PBIL Back to PBIL home page