(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFA

CP001509.YBFA        Location/Qualifiers
FT   CDS             689008..689214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /locus_tag="ECD_00657"
FT                   /product="DUF2517 family protein"
FT                   /note="similar to b0699"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42533"
FT                   /protein_id="ACT42533.1"
FT                   /translation="MELYREYPAWLIFLRRTYAVAAGVLALPFMLFWKDRARFYSYLHR
FT                   VWSKTSDKPVWMDQAEKATGDFY"
     MELYREYPAW LIFLRRTYAV AAGVLALPFM LFWKDRARFY SYLHRVWSKT SDKPVWMDQA        60
     EKATGDFY                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page