(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFB

CP001509.YBFB        Location/Qualifiers
FT   CDS             691299..691625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /locus_tag="ECD_00659"
FT                   /product="putative membrane protein"
FT                   /note="similar to b0702"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00659"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42535"
FT                   /protein_id="ACT42535.1"
FT                   /translation="MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSY
FT                   GMMVICFPTGIVFFIALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKR
FT                   IINK"
     MKYIIFLFRA IWLALSLLIL FFSMHRLSLL DSTRDVSELI SLMSYGMMVI CFPTGIVFFI        60
     ALIFIGTVSD IIGVRIDSKY IMAIIIWLYF LSGGYIQWFV LSKRIINK                    108
//

If you have problems or comments...

PBIL Back to PBIL home page