(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFC

CP001509.YBFC        Location/Qualifiers
FT   CDS             693173..693742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfC"
FT                   /locus_tag="ECD_00661"
FT                   /product="putative secreted protein"
FT                   /note="similar to b0704"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42537"
FT                   /protein_id="ACT42537.1"
FT                   /translation="MKRVLFFLLMIFVSFGVIADCEIQAKDHDCFTIFAKGTIFSAFPV
FT                   LNNKAMWRWYQNEDIGEYYWQTELGTCKNNKFTPSGARLLIRVGSLRLNENHAIKGTLQ
FT                   ELINTAEKTAFLGDRFRSYIRAGIYQKKSSDPAQLLAVLDNSIMVKYFKEEKPTYARMT
FT                   AHLPNKDESYECLTKIQHELLRSEEK"
     MKRVLFFLLM IFVSFGVIAD CEIQAKDHDC FTIFAKGTIF SAFPVLNNKA MWRWYQNEDI        60
     GEYYWQTELG TCKNNKFTPS GARLLIRVGS LRLNENHAIK GTLQELINTA EKTAFLGDRF       120
     RSYIRAGIYQ KKSSDPAQLL AVLDNSIMVK YFKEEKPTYA RMTAHLPNKD ESYECLTKIQ       180
     HELLRSEEK                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page