(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFE

CP001509.YBFE        Location/Qualifiers
FT   CDS             complement(671479..671772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /locus_tag="ECD_00642"
FT                   /product="LexA-regulated protein, CopB family"
FT                   /note="similar to b0685"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42518"
FT                   /protein_id="ACT42518.1"
FT                   /translation="MAKEQTDRTTLDLFAHERRPGRPKTNPLSRDEQLRINKRNQLKRD
FT                   KVRGLKRVELKLNAEAVEALNELAESRNMSRSELIEEMLMQQLAALRSQGIV"
     MAKEQTDRTT LDLFAHERRP GRPKTNPLSR DEQLRINKRN QLKRDKVRGL KRVELKLNAE        60
     AVEALNELAE SRNMSRSELI EEMLMQQLAA LRSQGIV                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page