(data stored in ACNUC7421 zone)

EMBL: CP001509.YBFGH

CP001509.YBFGH       Location/Qualifiers
FT   CDS             complement(675821..676471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybfGH"
FT                   /locus_tag="ECD_00647"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0690-b0691"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42523"
FT                   /protein_id="ACT42523.1"
FT                   /translation="MREMNQLVNTEDSAWPIIQNWLKDATNHTELLPVNKDLAETALYQ
FT                   LQVTTKSPMGALVYGSGGLLIDNGWLRIAGSGHPRLPRDPVSWTQRPEFAGVRALPIAD
FT                   DVAGGIFALNGGDLGEDTGCVYYFAPDTLNWESLEVGYSEFLQWALSGDLDTFYENVRW
FT                   QQWREDVIKLSATEAFTFYPFLWVQSEEARTRKVISLTELWEMQYQMKETFTQ"
     MREMNQLVNT EDSAWPIIQN WLKDATNHTE LLPVNKDLAE TALYQLQVTT KSPMGALVYG        60
     SGGLLIDNGW LRIAGSGHPR LPRDPVSWTQ RPEFAGVRAL PIADDVAGGI FALNGGDLGE       120
     DTGCVYYFAP DTLNWESLEV GYSEFLQWAL SGDLDTFYEN VRWQQWREDV IKLSATEAFT       180
     FYPFLWVQSE EARTRKVISL TELWEMQYQM KETFTQ                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page