(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGA

CP001509.YBGA        Location/Qualifiers
FT   CDS             697673..698182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /locus_tag="ECD_00667"
FT                   /product="DUF1722 family protein"
FT                   /note="similar to b0707"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42542"
FT                   /protein_id="ACT42542.1"
FT                   /translation="MNQQRFDDSTLIRIFALHELHRLKEHGLTRGALLDYHSRYKLVFL
FT                   AHSQPEYRKLGPFVADIHQWQNLDDFYNQYYQRVIVLLSHPANPRDHTNVLMHVQGYFR
FT                   PHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWPRVINL
FT                   RHSGVL"
     MNQQRFDDST LIRIFALHEL HRLKEHGLTR GALLDYHSRY KLVFLAHSQP EYRKLGPFVA        60
     DIHQWQNLDD FYNQYYQRVI VLLSHPANPR DHTNVLMHVQ GYFRPHIDST ERQQLAALID       120
     SYRRGEQPLL APLMRIKHYM ALYPDAWLSG QRYFELWPRV INLRHSGVL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page