(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGD

CP001509.YBGD        Location/Qualifiers
FT   CDS             complement(710799..711365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /locus_tag="ECD_00679"
FT                   /product="putative fimbrial-like adhesin protein"
FT                   /note="similar to b0719"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42554"
FT                   /protein_id="ACT42554.1"
FT                   /translation="MFKGQKTLTALAISLLFTAPVYAADEGSGEIHFKGEVIEAPCEIH
FT                   QDDIDKEVELGQVTTSHINQSHHSDAVAVDLRLVNCDLENSSNGSGGKISKVAVTFDSS
FT                   AKTTGADPILNNTSTGEATGVGVRLMNKDQSNIVLGTATPDIDLAPTSSEQTLNFFAWM
FT                   EQIDQATPVTPGAVTANATYVLDYK"
     MFKGQKTLTA LAISLLFTAP VYAADEGSGE IHFKGEVIEA PCEIHQDDID KEVELGQVTT        60
     SHINQSHHSD AVAVDLRLVN CDLENSSNGS GGKISKVAVT FDSSAKTTGA DPILNNTSTG       120
     EATGVGVRLM NKDQSNIVLG TATPDIDLAP TSSEQTLNFF AWMEQIDQAT PVTPGAVTAN       180
     ATYVLDYK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page