(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGE

CP001509.YBGE        Location/Qualifiers
FT   CDS             732970..733263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /locus_tag="ECD_00695"
FT                   /product="putative inner membrane protein in cydABX-ybgE
FT                   operon"
FT                   /note="similar to b0735"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42570"
FT                   /protein_id="ACT42570.1"
FT                   /translation="MSKIIATLYAVMDKRPLRALSFVMALLLAGCMFWDPSRFAAKTSE
FT                   LEIWHGLLLMWAVCAGVIHGVGFRPQKVLWQGIFCPLLADIVLIVGLIFFFF"
     MSKIIATLYA VMDKRPLRAL SFVMALLLAG CMFWDPSRFA AKTSELEIWH GLLLMWAVCA        60
     GVIHGVGFRP QKVLWQGIFC PLLADIVLIV GLIFFFF                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page