(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGI

CP001509.YBGI        Location/Qualifiers
FT   CDS             701391..702134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgI"
FT                   /locus_tag="ECD_00670"
FT                   /product="NIF3 family metal-binding protein"
FT                   /note="similar to b0710"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42545"
FT                   /protein_id="ACT42545.1"
FT                   /translation="MKNTELEQLINEKLNSAAISDYAPNGLQVEGKETVQKIVTGVTAC
FT                   QALLDEAVRLGADAVIVHHGYFWKGESPVIRGMKRNRLKTLLANDINLYGWHLPLDAHP
FT                   ELGNNAQLAALLGITVMGEIEPLVPWGELTMPVPGLELASWIEARLGRKPLWCGDTGPE
FT                   VVQRVAWCTGGGQSFIDSAARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERGG
FT                   IRALSEWLNENTDLDVTFIDIPNPA"
     MKNTELEQLI NEKLNSAAIS DYAPNGLQVE GKETVQKIVT GVTACQALLD EAVRLGADAV        60
     IVHHGYFWKG ESPVIRGMKR NRLKTLLAND INLYGWHLPL DAHPELGNNA QLAALLGITV       120
     MGEIEPLVPW GELTMPVPGL ELASWIEARL GRKPLWCGDT GPEVVQRVAW CTGGGQSFID       180
     SAARFGVDAF ITGEVSEQTI HSAREQGLHF YAAGHHATER GGIRALSEWL NENTDLDVTF       240
     IDIPNPA                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page