(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGL

CP001509.YBGL        Location/Qualifiers
FT   CDS             703729..704463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgL"
FT                   /locus_tag="ECD_00673"
FT                   /product="UPF0271 family protein"
FT                   /note="similar to b0713"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42548"
FT                   /protein_id="ACT42548.1"
FT                   /translation="MKIDLNADLGEGCASDAELLTLVSSANIACGFHAGDAQTMQACVR
FT                   EAIKNGVAIGAHPSFPDRENFGRSAMQLPPETVYAQTLYQIGALATIARAQGGVMRHVK
FT                   PHGMLYNQAAKEAQLADAIARAVYACDPALILVGLAGSELIRAGKQYGLTTREEVFADR
FT                   GYQADGSLVPRSQPGALIENEEQALAQTLEMVQHGRVKSITGEWATVTAQTVCLHGDGE
FT                   HALAFARRLRSTFAEKEIVVAA"
     MKIDLNADLG EGCASDAELL TLVSSANIAC GFHAGDAQTM QACVREAIKN GVAIGAHPSF        60
     PDRENFGRSA MQLPPETVYA QTLYQIGALA TIARAQGGVM RHVKPHGMLY NQAAKEAQLA       120
     DAIARAVYAC DPALILVGLA GSELIRAGKQ YGLTTREEVF ADRGYQADGS LVPRSQPGAL       180
     IENEEQALAQ TLEMVQHGRV KSITGEWATV TAQTVCLHGD GEHALAFARR LRSTFAEKEI       240
     VVAA                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page