(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGO

CP001509.YBGO        Location/Qualifiers
FT   CDS             complement(706485..707546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgO"
FT                   /locus_tag="ECD_00676"
FT                   /product="putative fimbrial protein"
FT                   /note="similar to b0716"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00676"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42551"
FT                   /protein_id="ACT42551.1"
FT                   /translation="MSAGKGVLLVICLLFLPLKSALALNCYFGSSGGSVEKSEVIQPFA
FT                   VPGNAKPGDKIWESDDIKIPVYCDNNTNGNFESEHVYAWVNPYPGVQDRYYQLGVTYNG
FT                   VDYDANQGKSRIDTNQCIDSKNIDIYTPEQIIAMGWQNKICSGDPANIHMSRTFLARMR
FT                   LYVKIREMPPHDYQSTLSDYIVVQFDGAGSVNEDPTAQNLKYHITGLENIRVLDCSVNF
FT                   SISPETQMIDFGKFNLLDIRRHNMTKTFSIKTTKSQNDQCTDGFKVSSSFYTEETLVEE
FT                   DKALLIGNGLKLRLLDENASPYTFNKYAEYADFTSDMLIYEKTYTAELSSIAGTPIEAG
FT                   PFDTVVLFKINYN"
     MSAGKGVLLV ICLLFLPLKS ALALNCYFGS SGGSVEKSEV IQPFAVPGNA KPGDKIWESD        60
     DIKIPVYCDN NTNGNFESEH VYAWVNPYPG VQDRYYQLGV TYNGVDYDAN QGKSRIDTNQ       120
     CIDSKNIDIY TPEQIIAMGW QNKICSGDPA NIHMSRTFLA RMRLYVKIRE MPPHDYQSTL       180
     SDYIVVQFDG AGSVNEDPTA QNLKYHITGL ENIRVLDCSV NFSISPETQM IDFGKFNLLD       240
     IRRHNMTKTF SIKTTKSQND QCTDGFKVSS SFYTEETLVE EDKALLIGNG LKLRLLDENA       300
     SPYTFNKYAE YADFTSDMLI YEKTYTAELS SIAGTPIEAG PFDTVVLFKI NYN              353
//

If you have problems or comments...

PBIL Back to PBIL home page