(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGQ

CP001509.YBGQ        Location/Qualifiers
FT   CDS             complement(708289..710739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgQ"
FT                   /locus_tag="ECD_00678"
FT                   /product="putative outer membrane protein"
FT                   /note="similar to b0718"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00678"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42553"
FT                   /protein_id="ACT42553.1"
FT                   /translation="MNIYRLSFVSCLVMAMPCALAVEFNLNVLDKSMRDRIDISLLKEK
FT                   GVIAPGEYFVSVAVNNNQISNGQKINWQKKGDKTIPCINDSLVDKFGLKPDIRQSLPQI
FT                   DRCIDFSSRPEMLFNFDQANQQLNISIPQAWLAWHSENWAPPSTWKEGVAGVLMDYNLF
FT                   ASNYRPQDGSSSTNLNAYGTTGINAGSWRLRSDYQLNNTDSEDSHEQSGGISRTYLFRP
FT                   LPQLGSKLTLGETDFSSNIFDGFSYTGAALASDDRMLPWELRGYAPQISGIAQTNATVT
FT                   ISQSGRVIYQKKVPPGPFIIDDLNQSVQGTLDVKVTEEDGRVNNFQVSAASTPFLTRQG
FT                   QVRYKLAAGQPRPSMSHQTENETFFSNEVSWGMLSNTSLYGGLLLSGDDYHSAAMGIGQ
FT                   NMLWLGALSFDVTWASSHFDTQQDERGLSYRFNYSKQVDATNSTISLAAYRFSDRHFHS
FT                   YANYLDHKYNDSDAQDEKQTISLSVGQPITPLNLNLYANLLHQTWWNADASTTANITAG
FT                   FNVDIGDWRDISISTSFNTTHYEDKDRDNQIYLSISLPFGNGGRVGYDMQNSSHSTTHR
FT                   MSWNDTLDERNSWGMSAGLQSDRPDNGAQVSGNYQHLSSAGEWDISGTYAANDYSSVSS
FT                   SWSGSFTATQYGAAFHRRSSTNEPRLMVSTDGVADIPVQGNLDYTNHFGIAVVPLISSY
FT                   QPSTVAVNMNDLPDGVTVAENVIKETWIEGAIGYKSLASRSGKDVNVIIRNASGQFPPL
FT                   GADIRQDDSGISVGMVGEEGHAWLSGVAENQKFTVVWGDSQHCSLHLPEHMEDTANRLI
FT                   LPCH"
     MNIYRLSFVS CLVMAMPCAL AVEFNLNVLD KSMRDRIDIS LLKEKGVIAP GEYFVSVAVN        60
     NNQISNGQKI NWQKKGDKTI PCINDSLVDK FGLKPDIRQS LPQIDRCIDF SSRPEMLFNF       120
     DQANQQLNIS IPQAWLAWHS ENWAPPSTWK EGVAGVLMDY NLFASNYRPQ DGSSSTNLNA       180
     YGTTGINAGS WRLRSDYQLN NTDSEDSHEQ SGGISRTYLF RPLPQLGSKL TLGETDFSSN       240
     IFDGFSYTGA ALASDDRMLP WELRGYAPQI SGIAQTNATV TISQSGRVIY QKKVPPGPFI       300
     IDDLNQSVQG TLDVKVTEED GRVNNFQVSA ASTPFLTRQG QVRYKLAAGQ PRPSMSHQTE       360
     NETFFSNEVS WGMLSNTSLY GGLLLSGDDY HSAAMGIGQN MLWLGALSFD VTWASSHFDT       420
     QQDERGLSYR FNYSKQVDAT NSTISLAAYR FSDRHFHSYA NYLDHKYNDS DAQDEKQTIS       480
     LSVGQPITPL NLNLYANLLH QTWWNADAST TANITAGFNV DIGDWRDISI STSFNTTHYE       540
     DKDRDNQIYL SISLPFGNGG RVGYDMQNSS HSTTHRMSWN DTLDERNSWG MSAGLQSDRP       600
     DNGAQVSGNY QHLSSAGEWD ISGTYAANDY SSVSSSWSGS FTATQYGAAF HRRSSTNEPR       660
     LMVSTDGVAD IPVQGNLDYT NHFGIAVVPL ISSYQPSTVA VNMNDLPDGV TVAENVIKET       720
     WIEGAIGYKS LASRSGKDVN VIIRNASGQF PPLGADIRQD DSGISVGMVG EEGHAWLSGV       780
     AENQKFTVVW GDSQHCSLHL PEHMEDTANR LILPCH                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page