(data stored in ACNUC7421 zone)

EMBL: CP001509.YBGS

CP001509.YBGS        Location/Qualifiers
FT   CDS             complement(743345..743725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgS"
FT                   /locus_tag="ECD_00706"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to b0753"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00706"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42581"
FT                   /protein_id="ACT42581.1"
FT                   /translation="MKMTKLATLFLTATLSLASGAALAADSGAQTNNGQANAAADAGQV
FT                   APDARENVAPNNVDNNGVNTGSGGTMLHSDGSSMNNDGMTKDEEHKNTMCKDGRCPDIN
FT                   KKVQTGDGINNDVDTKTDGTTQ"
     MKMTKLATLF LTATLSLASG AALAADSGAQ TNNGQANAAA DAGQVAPDAR ENVAPNNVDN        60
     NGVNTGSGGT MLHSDGSSMN NDGMTKDEEH KNTMCKDGRC PDINKKVQTG DGINNDVDTK       120
     TDGTTQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page