(data stored in ACNUC7421 zone)

EMBL: CP001509.YBHB

CP001509.YBHB        Location/Qualifiers
FT   CDS             complement(791426..791902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhB"
FT                   /locus_tag="ECD_00740"
FT                   /product="kinase inhibitor-like protein, UPF0098 family"
FT                   /note="similar to b0773"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42641"
FT                   /protein_id="ACT42641.1"
FT                   /translation="MKLISNDLRDGDKLPHRHVFNGMGYDGDNISPHLAWDDVPAGTKS
FT                   FVVTCYDPDAPTGSGWWHWVVVNLPADTRVLPQGFGSGLVAMPDGVLQTRTDFGKTGYD
FT                   GAAPPKGETHRYIFTVHALDIERIDVDEGASGAMVGFNVHFHSLASASITAMFS"
     MKLISNDLRD GDKLPHRHVF NGMGYDGDNI SPHLAWDDVP AGTKSFVVTC YDPDAPTGSG        60
     WWHWVVVNLP ADTRVLPQGF GSGLVAMPDG VLQTRTDFGK TGYDGAAPPK GETHRYIFTV       120
     HALDIERIDV DEGASGAMVG FNVHFHSLAS ASITAMFS                               158
//

If you have problems or comments...

PBIL Back to PBIL home page