(data stored in ACNUC7421 zone)

EMBL: CP001509.YBHL

CP001509.YBHL        Location/Qualifiers
FT   CDS             803876..804580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhL"
FT                   /locus_tag="ECD_00753"
FT                   /product="putative acetate transporter; BAX Inhibitor-1
FT                   family inner membrane protein"
FT                   /note="similar to b0786"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00753"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42654"
FT                   /protein_id="ACT42654.1"
FT                   /translation="MDRFPRSDSIVQPRAGLQTYMAQVYGWMTVGLLLTAFVAWYAANS
FT                   AAVMELLFTNRVFLIGLIIAQLALVIVLSAMIQKLSAGVTTMLFMLYSALTGLTLSSIF
FT                   IVYTAASIASTFVVTAGMFGAMSLYGYTTKRDLSGFGNMLFMALIGIVLASLVNFWLKS
FT                   EALMWAVTYIGVIVFVGLTAYDTQKLKNMGEQIDTRDTSNLRKYSILGALTLYLDFINL
FT                   FLMLLRIFGNRR"
     MDRFPRSDSI VQPRAGLQTY MAQVYGWMTV GLLLTAFVAW YAANSAAVME LLFTNRVFLI        60
     GLIIAQLALV IVLSAMIQKL SAGVTTMLFM LYSALTGLTL SSIFIVYTAA SIASTFVVTA       120
     GMFGAMSLYG YTTKRDLSGF GNMLFMALIG IVLASLVNFW LKSEALMWAV TYIGVIVFVG       180
     LTAYDTQKLK NMGEQIDTRD TSNLRKYSIL GALTLYLDFI NLFLMLLRIF GNRR             234
//

If you have problems or comments...

PBIL Back to PBIL home page