(data stored in ACNUC7421 zone)

EMBL: CP001509.YKFJ

CP001509.YKFJ        Location/Qualifiers
FT   CDS             257961..258227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykfJ"
FT                   /locus_tag="ECD_00230"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0235"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42129"
FT                   /protein_id="ACT42129.1"
FT                   /translation="MEWYMGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQR
FT                   VVGMPDLHPGRGYPIGAAFFSVGRFYPTRRRCNGAGNRNGPLL"
     MEWYMGKYIR PLSDAVFTIA SDDLWIESLA IQQLHTTANL PNMQRVVGMP DLHPGRGYPI        60
     GAAFFSVGRF YPTRRRCNGA GNRNGPLL                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page