(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGE

CP001509.YKGE        Location/Qualifiers
FT   CDS             291236..291955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgE"
FT                   /locus_tag="ECD_00262"
FT                   /product="cysteine-rich LutA family protein; putative
FT                   electron transport chain YkgEFG component"
FT                   /note="similar to b0306"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42161"
FT                   /protein_id="ACT42161.1"
FT                   /translation="MNVNFFVTCIGDALKSRMARDSVLLLEKLGCRVNFPEKQGCCGQP
FT                   AINSGYIKEAIPGMKNLIAALEDNDDPIISPAGSCTYAVKSYPTYLADEPEWASRAAKV
FT                   AARMQDLTSFIVNKLGVVDVGASLQGRAVYHPSCSLARKLGVKDEPLTLLKNVRGLELL
FT                   TFAEQDTCCGFGGTFSVKMAEISGEMVKEKVAHLMEVRPEYLIGADVSCLLNISGRLQR
FT                   EGQKVKVMHIAEVLMSR"
     MNVNFFVTCI GDALKSRMAR DSVLLLEKLG CRVNFPEKQG CCGQPAINSG YIKEAIPGMK        60
     NLIAALEDND DPIISPAGSC TYAVKSYPTY LADEPEWASR AAKVAARMQD LTSFIVNKLG       120
     VVDVGASLQG RAVYHPSCSL ARKLGVKDEP LTLLKNVRGL ELLTFAEQDT CCGFGGTFSV       180
     KMAEISGEMV KEKVAHLMEV RPEYLIGADV SCLLNISGRL QREGQKVKVM HIAEVLMSR        239
//

If you have problems or comments...

PBIL Back to PBIL home page