(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGF

CP001509.YKGF        Location/Qualifiers
FT   CDS             291966..293393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgF"
FT                   /locus_tag="ECD_00263"
FT                   /product="ferridoxin-like LutB family protein; putative
FT                   electron transport chain YkgEFG component"
FT                   /note="similar to b0307"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42162"
FT                   /protein_id="ACT42162.1"
FT                   /translation="MSIKTSNTDFKTRIRQQIEDPIMRKAVANAQQRIGANRQKMVDEL
FT                   GHWEEWRDRAAQIRDHVLSNLDAYLYQLSEKVTQNGGHVYFARTKEDATRYILQVAQRK
FT                   NARKVVKSKSMVTEEIGVNHVLQDAGIQVIETDLGEYILQLDQDPPSHVVVPAIHKDRH
FT                   QIRRVLHERLGYEGPETPEAMTLFIRQKIREDFLSAEIGITGCNFAVAETGSVCLVTNE
FT                   GNARMCTTLPKTHIAVMGMERIAPTFAEVDVLITMLARSAVGARLTGYNTWLTGPREAG
FT                   HVDGPEEFHLVIVDNGRSEVLASEFRDVLRCIRCGACMNTCPAYRHIGGHGYGSIYPGP
FT                   IGAVISPLLGGYKDFKDLPYACSLCTACDNVCPVRIPLSKLILRHRRVMAEKGITAKAE
FT                   QRAIKMFAYANSHPGLWKVGMMAGAHAASWFINGGKTPLKFGAISDWMEARDLPEADGE
FT                   SFRSWFKKHQAQEKKNG"
     MSIKTSNTDF KTRIRQQIED PIMRKAVANA QQRIGANRQK MVDELGHWEE WRDRAAQIRD        60
     HVLSNLDAYL YQLSEKVTQN GGHVYFARTK EDATRYILQV AQRKNARKVV KSKSMVTEEI       120
     GVNHVLQDAG IQVIETDLGE YILQLDQDPP SHVVVPAIHK DRHQIRRVLH ERLGYEGPET       180
     PEAMTLFIRQ KIREDFLSAE IGITGCNFAV AETGSVCLVT NEGNARMCTT LPKTHIAVMG       240
     MERIAPTFAE VDVLITMLAR SAVGARLTGY NTWLTGPREA GHVDGPEEFH LVIVDNGRSE       300
     VLASEFRDVL RCIRCGACMN TCPAYRHIGG HGYGSIYPGP IGAVISPLLG GYKDFKDLPY       360
     ACSLCTACDN VCPVRIPLSK LILRHRRVMA EKGITAKAEQ RAIKMFAYAN SHPGLWKVGM       420
     MAGAHAASWF INGGKTPLKF GAISDWMEAR DLPEADGESF RSWFKKHQAQ EKKNG            475
//

If you have problems or comments...

PBIL Back to PBIL home page