(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGG

CP001509.YKGG        Location/Qualifiers
FT   CDS             293386..294081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgG"
FT                   /locus_tag="ECD_00264"
FT                   /product="LutC family protein; putative electron transport
FT                   chain YkgEFG component"
FT                   /note="similar to b0308"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42163"
FT                   /protein_id="ACT42163.1"
FT                   /translation="MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQ
FT                   RCDAFIQFASDVMLTRCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQ
FT                   QECNAVVWDPAKGAENISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPEYS
FT                   LFILRKSTILPRVAQLAEKLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVK
FT                   AVYLIIEDC"
     MDNRGEFLNN VAQALGRPLR LEPQAEDAPL NNYANERLTQ LNQQQRCDAF IQFASDVMLT        60
     RCELTSEAKA AEAAIRLCKE LGDQSVVISG DTRLEELGIS ERLQQECNAV VWDPAKGAEN       120
     ISQAEQAKVG VVYAEYGLTE SGGVVLFSAA ERGRSLSLLP EYSLFILRKS TILPRVAQLA       180
     EKLHQKAQAG ERMPSCINII SGPSSTADIE LIKVVGVHGP VKAVYLIIED C                231
//

If you have problems or comments...

PBIL Back to PBIL home page