(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGH

CP001509.YKGH        Location/Qualifiers
FT   CDS             complement(294324..294992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgH"
FT                   /locus_tag="ECD_00266"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to b0310"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42165"
FT                   /protein_id="ACT42165.1"
FT                   /translation="MREQIKQDIDLIEILFYLKKKIRVILFIMAICMAMVLLFLYINKD
FT                   NIKVIYSLKINQTTPGILVSCDSNNNFACQTTMTEDVIQRITTFFHTSPDVKNREIRLE
FT                   WSGDKRALPTAEEEISRVQASIIKWYASEYHNGRQVLDEIQTPSAINSELYTKMIYLTR
FT                   NWSLYPNGDGCVTISSPEIKNKYPAAICLALGFFLSIVISVMFCLVKKMVDEYQQNSGQ
FT                   "
     MREQIKQDID LIEILFYLKK KIRVILFIMA ICMAMVLLFL YINKDNIKVI YSLKINQTTP        60
     GILVSCDSNN NFACQTTMTE DVIQRITTFF HTSPDVKNRE IRLEWSGDKR ALPTAEEEIS       120
     RVQASIIKWY ASEYHNGRQV LDEIQTPSAI NSELYTKMIY LTRNWSLYPN GDGCVTISSP       180
     EIKNKYPAAI CLALGFFLSI VISVMFCLVK KMVDEYQQNS GQ                          222
//

If you have problems or comments...

PBIL Back to PBIL home page