(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGL

CP001509.YKGL        Location/Qualifiers
FT   CDS             282295..282522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgL"
FT                   /locus_tag="ECD_00254"
FT                   /product="uncharacterized protein"
FT                   /note="similar to b0295"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42153"
FT                   /protein_id="ACT42153.1"
FT                   /translation="MQAAPQREETEWRVQSKRGLMPAYRGEAGQQVNIKIMEYSERNVR
FT                   QLASNEQEEYIPRKINVGVINTPTLIRSDY"
     MQAAPQREET EWRVQSKRGL MPAYRGEAGQ QVNIKIMEYS ERNVRQLASN EQEEYIPRKI        60
     NVGVINTPTL IRSDY                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page