(data stored in ACNUC7421 zone)

EMBL: CP001509.YKGM

CP001509.YKGM        Location/Qualifiers
FT   CDS             complement(282697..282960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykgM"
FT                   /locus_tag="ECD_00255"
FT                   /product="50S ribosomal protein L31 type B; alternative
FT                   zinc-limitation L31 protein"
FT                   /note="similar to b0296"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42154"
FT                   /protein_id="ACT42154.1"
FT                   /translation="MKPNIHPEYRTVVFHDTSVDEYFKIGSTIKTDREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGKLRTVASEGNVARFTQRFGRFVSTKKGA"
     MKPNIHPEYR TVVFHDTSVD EYFKIGSTIK TDREIELDGV TYPYVTIDVS SKSHPFYTGK        60
     LRTVASEGNV ARFTQRFGRF VSTKKGA                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page