(data stored in ACNUC7421 zone)

EMBL: CP001509.YKIA

CP001509.YKIA        Location/Qualifiers
FT   CDS             373294..373575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykiA"
FT                   /locus_tag="ECD_00339"
FT                   /product="hypothetical protein"
FT                   /note="similar to b0392"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42238"
FT                   /protein_id="ACT42238.1"
FT                   /translation="MLQSRNDHLRQTALRNAHTPALLLTTLTEPQDRSLAINNPQLAAD
FT                   VKTAWLKEDPSLLLFVEQPDLSLLRDLVKTGATRKIRSEARHRLEEKQ"
     MLQSRNDHLR QTALRNAHTP ALLLTTLTEP QDRSLAINNP QLAADVKTAW LKEDPSLLLF        60
     VEQPDLSLLR DLVKTGATRK IRSEARHRLE EKQ                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page