(data stored in ACNUC7421 zone)

EMBL: CP001509.YLBF

CP001509.YLBF        Location/Qualifiers
FT   CDS             518772..519587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylbF"
FT                   /locus_tag="ECD_00470"
FT                   /product="putative anaerobic allantoin catabolic oxamate
FT                   carbamoyltransferase; DUF2877 family protein"
FT                   /note="similar to b0520"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42369"
FT                   /protein_id="ACT42369.2"
FT                   /translation="MTIIHPLLASRSAPNYRQSWRLAGVWRRAINLMTESGELLTLHRQ
FT                   GSGFGPGGWVLRRAQFDALCGGLCGNERPQVVAQGIRLGRFTVKQPQRYCLLRITPPAH
FT                   PQPLAAAWMQRAEETGLFGPLALAASDPLTAELRQFRHCFQAALNGVKTDWRHWLGKGP
FT                   GLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFA
FT                   SPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLGQQLLQGKP"
     MTIIHPLLAS RSAPNYRQSW RLAGVWRRAI NLMTESGELL TLHRQGSGFG PGGWVLRRAQ        60
     FDALCGGLCG NERPQVVAQG IRLGRFTVKQ PQRYCLLRIT PPAHPQPLAA AWMQRAEETG       120
     LFGPLALAAS DPLTAELRQF RHCFQAALNG VKTDWRHWLG KGPGLTPSHD DTLSGMLLAA       180
     WYYGALDARS GRPFFACSDN LQLVTTAVSV SYLRYAAQGY FASPLLHFVH ALSCPKRTAV       240
     AIDSLLALGH TSGADTLLGF WLGQQLLQGK P                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page