(data stored in ACNUC7421 zone)

EMBL: CP001509.YOEA

CP001509.YOEA        Location/Qualifiers
FT   CDS             517502..518761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yoeA"
FT                   /locus_tag="ECD_00469"
FT                   /product="hypothetical protein"
FT                   /note="similar to b4507-b0519(b4582); pseudo in K-12 MG1655
FT                   (interrupted by frameshift)"
FT                   /db_xref="EnsemblGenomes-Gn:ECD_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT42368"
FT                   /protein_id="ACT42368.1"
FT                   /translation="MFTSVAQANAAVIEQIRRARPHWLDVQPASSLISELNEGKTLLHA
FT                   GPPMRWQEMTGPMKGACVGACLFEGWAKDEAQALAMLEQGEVNFIPCHHVNAVGPMGGI
FT                   TSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAAL
FT                   GRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFL
FT                   SVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNT
FT                   PQGLFFTGFSQEQANPDMGDSAITETFGIGGAAMIAAPGVTRFVGAGGMEAARAVSEEM
FT                   AEIYLERNMQLQIPGWDFQGACLGLDIRRVVETGITPLINTGIAHKEAGIGQIGAGTVR
FT                   APLACFEQALEALAESMGIG"
     MFTSVAQANA AVIEQIRRAR PHWLDVQPAS SLISELNEGK TLLHAGPPMR WQEMTGPMKG        60
     ACVGACLFEG WAKDEAQALA MLEQGEVNFI PCHHVNAVGP MGGITSASMP MLVVENVTDG       120
     NRAYCNLNEG IGKVMRFGAY GEDVLTRHRW MRDVLMPVLS AALGRMERGI DLTAMMAQGI       180
     TMGDEFHQRN IASSALLMRA LAPQIARLDH DKQHIAEVMD FLSVTDQFFL NLAMAYCKAA       240
     MDAGAMIRAG SIVTAMTRNG NMFGIRVSGL GERWFTAPVN TPQGLFFTGF SQEQANPDMG       300
     DSAITETFGI GGAAMIAAPG VTRFVGAGGM EAARAVSEEM AEIYLERNMQ LQIPGWDFQG       360
     ACLGLDIRRV VETGITPLIN TGIAHKEAGI GQIGAGTVRA PLACFEQALE ALAESMGIG        419
//

If you have problems or comments...

PBIL Back to PBIL home page