(data stored in ACNUC30630 zone)

EMBL: CP001515.CLPC

CP001515.CLPC        Location/Qualifiers
FT   CDS             781404..783956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="Balac_0665"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ACS46038"
FT                   /protein_id="ACS46038.1"
FT                   /translation="MFERFTDRARRVIVLAQEEARALQHNYIGTEHLLLGLIREGDGVA
FT                   AKALEAKGVTLEDTRKQVEEMIGKGTAAPTGHIPFTPHAKQVLELSLREALQLGHSYIG
FT                   TEHILLGLIREGEGVGTQVLIKMDVDLSDLRSTTIDMIRGNSGNGEGDKGDMANAGSVQ
FT                   DKRSQSGSAILDQFGRNLTAEAKDGKLDPVIGRSTEIERVMVVLSRRTKNNPVLIGEPG
FT                   VGKTAVVEGLAQKIVAGDVPETLKDKQVYSLDLGSMVAGSRYRGDFEERLKKVLKEIKT
FT                   RGDIVLFIDEIHTIVGAGSADGALGASDMLKPMLARGELQTIGATTTDEYRKYIEKDAA
FT                   LERRFQPIQVSEPSIAETIEILKGLRARYENHHHVTITDGALQSAAELSARYIQDRNLP
FT                   DKAIDLIDEAGARLRIKRLTAPPELKELDNRIARIAKEKDQTIKDQQFEKAAELRDKQE
FT                   KLEAERKEKEKSWREGESDVRMVVDEDVIAEVISQSTGIPVFKLTQAESKKLMSMEKEL
FT                   HKRIIGQDEAVSALSRSIRRTRVGLKDPKRPAGSFIFAGPTGVGKTELAKALAQFLFDD
FT                   EDALIRVDMSEFSEKYAASRLFGAPPGYVGYEEGGELTEKVRRKPFSVVLFDEIEKAHP
FT                   DIFNTLLQVLDDGHLTDGQGRKVDFKNTIIILTTNLGTRDIAKTANTGFTMGGNTESSY
FT                   QRMKDQVSSELKQQFRPEFLNRLDDIIVFRQLTEPQVRQIVDLDVTKINDRLFERHMEL
FT                   DLTDKAKDLLAEKGFDPLLGARPLRRVIQRDIEDTISEKILMGDLHDNERVIVDAEGDG
FT                   ILGEFTFRGEPFELPAAGEGDESKDVVPEPAAAASEAE"
     MFERFTDRAR RVIVLAQEEA RALQHNYIGT EHLLLGLIRE GDGVAAKALE AKGVTLEDTR        60
     KQVEEMIGKG TAAPTGHIPF TPHAKQVLEL SLREALQLGH SYIGTEHILL GLIREGEGVG       120
     TQVLIKMDVD LSDLRSTTID MIRGNSGNGE GDKGDMANAG SVQDKRSQSG SAILDQFGRN       180
     LTAEAKDGKL DPVIGRSTEI ERVMVVLSRR TKNNPVLIGE PGVGKTAVVE GLAQKIVAGD       240
     VPETLKDKQV YSLDLGSMVA GSRYRGDFEE RLKKVLKEIK TRGDIVLFID EIHTIVGAGS       300
     ADGALGASDM LKPMLARGEL QTIGATTTDE YRKYIEKDAA LERRFQPIQV SEPSIAETIE       360
     ILKGLRARYE NHHHVTITDG ALQSAAELSA RYIQDRNLPD KAIDLIDEAG ARLRIKRLTA       420
     PPELKELDNR IARIAKEKDQ TIKDQQFEKA AELRDKQEKL EAERKEKEKS WREGESDVRM       480
     VVDEDVIAEV ISQSTGIPVF KLTQAESKKL MSMEKELHKR IIGQDEAVSA LSRSIRRTRV       540
     GLKDPKRPAG SFIFAGPTGV GKTELAKALA QFLFDDEDAL IRVDMSEFSE KYAASRLFGA       600
     PPGYVGYEEG GELTEKVRRK PFSVVLFDEI EKAHPDIFNT LLQVLDDGHL TDGQGRKVDF       660
     KNTIIILTTN LGTRDIAKTA NTGFTMGGNT ESSYQRMKDQ VSSELKQQFR PEFLNRLDDI       720
     IVFRQLTEPQ VRQIVDLDVT KINDRLFERH MELDLTDKAK DLLAEKGFDP LLGARPLRRV       780
     IQRDIEDTIS EKILMGDLHD NERVIVDAEG DGILGEFTFR GEPFELPAAG EGDESKDVVP       840
     EPAAAASEAE                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page