(data stored in ACNUC30630 zone)

EMBL: CP001515.ILVH

CP001515.ILVH        Location/Qualifiers
FT   CDS             complement(342689..343243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="Balac_0275"
FT                   /product="acetolactate synthase 3 regulatory subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0440 Acetolactate synthase, small (regulatory
FT                   subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45666"
FT                   /protein_id="ACS45666.1"
FT                   /translation="MASYPASKPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRITVTADVEEVPLEQIIKQLNKLLHVLKIVDLDESTTVERELVLIKVAA
FT                   DQSNRSDVLEIVRLFRVRVVDVNPESLTIEATGAGGKIDALLGLLDHYGIIELVRSGAV
FT                   AMTRGPRALSEKVVGSEITGR"
     MASYPASKPG SQRHTLSVLV ENRPGVLARI AGLFARRAFN INSLSVSPTE RPDISRITVT        60
     ADVEEVPLEQ IIKQLNKLLH VLKIVDLDES TTVERELVLI KVAADQSNRS DVLEIVRLFR       120
     VRVVDVNPES LTIEATGAGG KIDALLGLLD HYGIIELVRS GAVAMTRGPR ALSEKVVGSE       180
     ITGR                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page