(data stored in ACNUC30630 zone)

EMBL: CP001515.PE106

CP001515.PE106       Location/Qualifiers
FT   CDS             complement(127054..127317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45504"
FT                   /protein_id="ACS45504.1"
FT                   /translation="MGILFINGGEIGGNTAHLGHAFLEGRDFTQIDLAGKRLFFLFRGG
FT                   APTQQMYERGEYTINRFAGLYGMDYMGMARNASEARALAAKL"
     MGILFINGGE IGGNTAHLGH AFLEGRDFTQ IDLAGKRLFF LFRGGAPTQQ MYERGEYTIN        60
     RFAGLYGMDY MGMARNASEA RALAAKL                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page