(data stored in ACNUC30630 zone)

EMBL: CP001515.PE112

CP001515.PE112       Location/Qualifiers
FT   CDS             complement(131417..132403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0116"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45510"
FT                   /protein_id="ACS45510.1"
FT                   /translation="MTALELTPVWDKTFPQSDKVEHGKITFHNRYGIELAADVYKPKRV
FT                   PANGRFKAIAVSGPFGAVKEQASGLYAQTLAERGFLTIAFDPSFTGESGGSPRAVASPD
FT                   INTEDFSAAVDYLANRTDVDPEGIGIVGICGFGGLALNAAANDPRIKATVASTMYDMSR
FT                   VTANGYFDADDSAAKRNEMRTQLAKQRTEDYANGDYARAGGVIDPLPDDAPQFVRDYHA
FT                   YYKTPRGYHARSVNSNAGWNVTSSLPFMNMPLMTYIGEIENPALLIHGEKAHSLYFSKA
FT                   AYEKLEHGVNPANKELLIIPGANHTDLYDNLNAIPFDTIAGFFTRNL"
     MTALELTPVW DKTFPQSDKV EHGKITFHNR YGIELAADVY KPKRVPANGR FKAIAVSGPF        60
     GAVKEQASGL YAQTLAERGF LTIAFDPSFT GESGGSPRAV ASPDINTEDF SAAVDYLANR       120
     TDVDPEGIGI VGICGFGGLA LNAAANDPRI KATVASTMYD MSRVTANGYF DADDSAAKRN       180
     EMRTQLAKQR TEDYANGDYA RAGGVIDPLP DDAPQFVRDY HAYYKTPRGY HARSVNSNAG       240
     WNVTSSLPFM NMPLMTYIGE IENPALLIHG EKAHSLYFSK AAYEKLEHGV NPANKELLII       300
     PGANHTDLYD NLNAIPFDTI AGFFTRNL                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page