(data stored in ACNUC30630 zone)

EMBL: CP001515.PE128

CP001515.PE128       Location/Qualifiers
FT   CDS             147437..148873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0132"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system permease component"
FT                   /note="COG0559 Branched-chain amino acid ABC-typetransport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45526"
FT                   /protein_id="ACS45526.1"
FT                   /translation="MASMVSQPQRRAERGRRRKGLAIVCAGIAGLLLAMLASMIGVPNA
FT                   VAAEAVDKCVPNAEHGCVSGILQTQDKTPIPDVTVTLGGEEEATATTAEDGAWAFEVNA
FT                   DGEYTVSIDKAVAEKYKLGESGATVEIAKKSFSKQRAVVRFDKAAAGSAAETESGNADS
FT                   AKSGEQTAANTAQAGDDGKGSGFWSRFWQQLYSGCIFGLMLGLMAVGMNLVYGTTGLSS
FT                   FSHGEQVTLGGLMAYVGTQMLHMPVVLSAIFAVAIGALAGWVQNQLVWAPLRHKRVGVM
FT                   QQMIVTIGLSMALQYIYQFFFGGDIKGIVKSVPEGIQLGPIVTNAPTLIAAAIALVTIV
FT                   SVTVFLYCTRLGRATRAVSDNAALAAASGINVDSVVRIVWILSCGLAALSGVLIGIHLN
FT                   GIAWNTGVTLLMLMFAAVTLGGLGTANGALVGALIVGIVADMSTLVIPSDMRYASALAI
FT                   LILVLLIRPQGIFGKQKRVG"
     MASMVSQPQR RAERGRRRKG LAIVCAGIAG LLLAMLASMI GVPNAVAAEA VDKCVPNAEH        60
     GCVSGILQTQ DKTPIPDVTV TLGGEEEATA TTAEDGAWAF EVNADGEYTV SIDKAVAEKY       120
     KLGESGATVE IAKKSFSKQR AVVRFDKAAA GSAAETESGN ADSAKSGEQT AANTAQAGDD       180
     GKGSGFWSRF WQQLYSGCIF GLMLGLMAVG MNLVYGTTGL SSFSHGEQVT LGGLMAYVGT       240
     QMLHMPVVLS AIFAVAIGAL AGWVQNQLVW APLRHKRVGV MQQMIVTIGL SMALQYIYQF       300
     FFGGDIKGIV KSVPEGIQLG PIVTNAPTLI AAAIALVTIV SVTVFLYCTR LGRATRAVSD       360
     NAALAAASGI NVDSVVRIVW ILSCGLAALS GVLIGIHLNG IAWNTGVTLL MLMFAAVTLG       420
     GLGTANGALV GALIVGIVAD MSTLVIPSDM RYASALAILI LVLLIRPQGI FGKQKRVG         478
//

If you have problems or comments...

PBIL Back to PBIL home page