(data stored in ACNUC30630 zone)

EMBL: CP001515.PE131

CP001515.PE131       Location/Qualifiers
FT   CDS             150853..151668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0135"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /note="COG0410 ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45529"
FT                   /protein_id="ACS45529.1"
FT                   /translation="MPDTATLTPTEAPDVSTLDRSHIHAGEPLLDADNLVAGYLPGVNI
FT                   LNGASLTLHDGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLTLKGQDITNLRADKLVS
FT                   RGVGFVPQTENVFPSLTIAENMHMGAYQAPKLFNERFDYVCSIFPKLGDRRNQLAGQLS
FT                   GGERQMVAMGRALMMQPSVLLLDEPSAGLSPMMQDETFIRVRQVNKAGVSVVIVEQNAR
FT                   RCLQICDRGYVLDQGRNAYSCRGRDLMNDPKVISLYLGNLEEEVEKENK"
     MPDTATLTPT EAPDVSTLDR SHIHAGEPLL DADNLVAGYL PGVNILNGAS LTLHDGEIVG        60
     IIGPNGAGKS TLLKSLFGLV HIHSGKLTLK GQDITNLRAD KLVSRGVGFV PQTENVFPSL       120
     TIAENMHMGA YQAPKLFNER FDYVCSIFPK LGDRRNQLAG QLSGGERQMV AMGRALMMQP       180
     SVLLLDEPSA GLSPMMQDET FIRVRQVNKA GVSVVIVEQN ARRCLQICDR GYVLDQGRNA       240
     YSCRGRDLMN DPKVISLYLG NLEEEVEKEN K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page