(data stored in ACNUC30630 zone)

EMBL: CP001515.PE143

CP001515.PE143       Location/Qualifiers
FT   CDS             164817..166208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0147"
FT                   /product="transmembrane transport protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45541"
FT                   /protein_id="ACS45541.1"
FT                   /translation="MTAVETETEAGRRAPALAGERAHALRRAGKSSVGTIIAASMVGTT
FT                   IEFYDFYAYGTAAANYFPRVFFSDATNPTVALLLSLVTFAVAFLARPVGSLIFGHFGDS
FT                   IGRKATLVVSLMTMGVATFLIGCLPGYDMWGVWAVLALCVCRFVQGIGLGGEWSGAALV
FT                   ATENAPANKRALYGSFPELGAPIGFFLCNGTYVLLELFNDDAAMLAWGWRVPFLLSSLL
FT                   VVVGLLVRVHMEETPAFRAAKQDQRVVKAPALEVFRTSWRQVLQATFLVAVTYTLFYTL
FT                   ATWSLAWATKSDAQGGGGLGFSTKEYMTMLMVSVCVFALFIVLSCVFADRIGRRRVIIG
FT                   SSVALLAFAALFPLLMNRAVVGVHNTAAAMLFLCLGFALMGIAFGPIGALLPELFSVNV
FT                   RYTGSGIGYNIAAIVGAAFVPSVATWLSSHWGVGSVGLYLGVMALCCLVAILTCRETKN
FT                   VDYMQ"
     MTAVETETEA GRRAPALAGE RAHALRRAGK SSVGTIIAAS MVGTTIEFYD FYAYGTAAAN        60
     YFPRVFFSDA TNPTVALLLS LVTFAVAFLA RPVGSLIFGH FGDSIGRKAT LVVSLMTMGV       120
     ATFLIGCLPG YDMWGVWAVL ALCVCRFVQG IGLGGEWSGA ALVATENAPA NKRALYGSFP       180
     ELGAPIGFFL CNGTYVLLEL FNDDAAMLAW GWRVPFLLSS LLVVVGLLVR VHMEETPAFR       240
     AAKQDQRVVK APALEVFRTS WRQVLQATFL VAVTYTLFYT LATWSLAWAT KSDAQGGGGL       300
     GFSTKEYMTM LMVSVCVFAL FIVLSCVFAD RIGRRRVIIG SSVALLAFAA LFPLLMNRAV       360
     VGVHNTAAAM LFLCLGFALM GIAFGPIGAL LPELFSVNVR YTGSGIGYNI AAIVGAAFVP       420
     SVATWLSSHW GVGSVGLYLG VMALCCLVAI LTCRETKNVD YMQ                         463
//

If you have problems or comments...

PBIL Back to PBIL home page