(data stored in ACNUC30630 zone)

EMBL: CP001515.PE150

CP001515.PE150       Location/Qualifiers
FT   CDS             complement(176166..176801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45548"
FT                   /protein_id="ACS45548.1"
FT                   /translation="MIAGGIFRQDNPYNTVMNRIGDIAMLSVAWFVCCLPVVTIGVSTA
FT                   AACEVAREMQEDRDNGIFKGFWRAIKRRFGTGMLLTLFLGVLIALGAFDLWWISRSMAG
FT                   DMASVLYGVTLAVFIIVAMLFAFLLPLSGRSKLSAGEQIKQSAKLATMKPFIALVVAAI
FT                   YALPIVLLATLPSAVMWVPLVWCIFGGGASAWAQMWLIRRAFDLQPQD"
     MIAGGIFRQD NPYNTVMNRI GDIAMLSVAW FVCCLPVVTI GVSTAAACEV AREMQEDRDN        60
     GIFKGFWRAI KRRFGTGMLL TLFLGVLIAL GAFDLWWISR SMAGDMASVL YGVTLAVFII       120
     VAMLFAFLLP LSGRSKLSAG EQIKQSAKLA TMKPFIALVV AAIYALPIVL LATLPSAVMW       180
     VPLVWCIFGG GASAWAQMWL IRRAFDLQPQ D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page