(data stored in ACNUC30630 zone)

EMBL: CP001515.PE153

CP001515.PE153       Location/Qualifiers
FT   CDS             178390..179655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0157"
FT                   /product="hypothetical protein"
FT                   /note="COG2942 N-acyl-D-glucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45551"
FT                   /protein_id="ACS45551.1"
FT                   /translation="MANTDPKYQIGTPENKKFLDISRDNLIAFGRRFPAVDGSSYWLGD
FT                   DGTPWKDRNRATWITCRMTHVYSLATLLGVDGAAELVDDGIRGLRGVLHDEEHDGWYAE
FT                   ITPDICHMPTKQAYAHAFVLLAASSALLAGRPGAKELLEQAENVYLTKFWDDKIGLSVD
FT                   TWDTDFAELDTYRGLNANMHSVEACLAVADVTGDESWRTRAGRIIEHVLKWAEENNWRI
FT                   PEHFNSDWEPELEFNADKPDDQFKPYGATPGHGIEWARLITQYALSVYGKDGVLNGDGK
FT                   KYLDAAEHLFNRAVEDAWNADGAPGIVYTTDWDGKPVVHDRMHWTLAEGVNTAATLYHV
FT                   TGKKEYADWYATFLEYIDTYLMDHKNGSWFHQLNRENEVIDTVWPGKSDLYHATQAMMI
FT                   PLRDPALSIAPATKKGVEEGLN"
     MANTDPKYQI GTPENKKFLD ISRDNLIAFG RRFPAVDGSS YWLGDDGTPW KDRNRATWIT        60
     CRMTHVYSLA TLLGVDGAAE LVDDGIRGLR GVLHDEEHDG WYAEITPDIC HMPTKQAYAH       120
     AFVLLAASSA LLAGRPGAKE LLEQAENVYL TKFWDDKIGL SVDTWDTDFA ELDTYRGLNA       180
     NMHSVEACLA VADVTGDESW RTRAGRIIEH VLKWAEENNW RIPEHFNSDW EPELEFNADK       240
     PDDQFKPYGA TPGHGIEWAR LITQYALSVY GKDGVLNGDG KKYLDAAEHL FNRAVEDAWN       300
     ADGAPGIVYT TDWDGKPVVH DRMHWTLAEG VNTAATLYHV TGKKEYADWY ATFLEYIDTY       360
     LMDHKNGSWF HQLNRENEVI DTVWPGKSDL YHATQAMMIP LRDPALSIAP ATKKGVEEGL       420
     N                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page