(data stored in ACNUC30630 zone)

EMBL: CP001515.PE162

CP001515.PE162       Location/Qualifiers
FT   CDS             complement(189896..191617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0166"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45560"
FT                   /protein_id="ACS45560.1"
FT                   /translation="MIRIGLRDAKAHFHRLVMSIIAIALGVSFVVGSFCFRSMLNDQVT
FT                   QLMGTNSDHDVYVRGTTEEQNDSSFATSGPISSGTSYNKIDTSLVTQIEQVKGIDNVSP
FT                   PERTIGATLLDHDGNAVVTTGAPTLMISASSEHPWRAANFIAGTYATGEHEIALSQDAA
FT                   KKAGLQVGDTTRLIVNGEPHTMKVSGVFTTQTAELGVLIILAQPALVNQLMQLQGEDTS
FT                   KVDKIGVYGNRTTPLTVQKQHQLADRINKALPKDSKAHAVTGQSVRDEATKSTQESLGF
FT                   VQPLILIFAVIALFVGAFIIANTFTMIVRDSMRGYALLRSVGASPAQVFFSVVIQALIL
FT                   GVIGSVLGVLLGWGLIELIDWGLSKGGFPLSGSPTPSPTAVAVGFMVGVVVTVIGSAIP
FT                   ARTAATAPPIQAMNETMNPEKPVTARGWIGAGMVAFGALCWLLCWLLAAKKVSWAWLTT
FT                   VGTGWLLGLGGVCTAGGVIVLAPALVTGAAKVLGWLPSRIPGDRHAGHPQHRPHETSHR
FT                   QHGRRPVRGRGNRQLPERARLVNARLGERYDRRQSSCRLCARLRRALAIRLAEGRQ"
     MIRIGLRDAK AHFHRLVMSI IAIALGVSFV VGSFCFRSML NDQVTQLMGT NSDHDVYVRG        60
     TTEEQNDSSF ATSGPISSGT SYNKIDTSLV TQIEQVKGID NVSPPERTIG ATLLDHDGNA       120
     VVTTGAPTLM ISASSEHPWR AANFIAGTYA TGEHEIALSQ DAAKKAGLQV GDTTRLIVNG       180
     EPHTMKVSGV FTTQTAELGV LIILAQPALV NQLMQLQGED TSKVDKIGVY GNRTTPLTVQ       240
     KQHQLADRIN KALPKDSKAH AVTGQSVRDE ATKSTQESLG FVQPLILIFA VIALFVGAFI       300
     IANTFTMIVR DSMRGYALLR SVGASPAQVF FSVVIQALIL GVIGSVLGVL LGWGLIELID       360
     WGLSKGGFPL SGSPTPSPTA VAVGFMVGVV VTVIGSAIPA RTAATAPPIQ AMNETMNPEK       420
     PVTARGWIGA GMVAFGALCW LLCWLLAAKK VSWAWLTTVG TGWLLGLGGV CTAGGVIVLA       480
     PALVTGAAKV LGWLPSRIPG DRHAGHPQHR PHETSHRQHG RRPVRGRGNR QLPERARLVN       540
     ARLGERYDRR QSSCRLCARL RRALAIRLAE GRQ                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page