(data stored in ACNUC30630 zone)

EMBL: CP001515.PE175

CP001515.PE175       Location/Qualifiers
FT   CDS             209808..210449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0179"
FT                   /product="hypothetical protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45573"
FT                   /protein_id="ACS45573.1"
FT                   /translation="MSDMERDARRREVRAAGGTRLTVADLINVGVFGAVYFALVGVAAL
FT                   ASMAVFGVAGNILLPAIAAVLAGPVFMLMVARVRRFGAITLMGLMLGLFLFVSGHFATS
FT                   LVTAIVFPLAADCIARFGAWRRPWALMLSYVVFSFGCTGPILPLWMMKDAYIASLERKG
FT                   KDAAYIDALFGAVNGTTFVVAMVAIVIGALVGGLFGMRLMRRHFLKAAVA"
     MSDMERDARR REVRAAGGTR LTVADLINVG VFGAVYFALV GVAALASMAV FGVAGNILLP        60
     AIAAVLAGPV FMLMVARVRR FGAITLMGLM LGLFLFVSGH FATSLVTAIV FPLAADCIAR       120
     FGAWRRPWAL MLSYVVFSFG CTGPILPLWM MKDAYIASLE RKGKDAAYID ALFGAVNGTT       180
     FVVAMVAIVI GALVGGLFGM RLMRRHFLKA AVA                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page