(data stored in ACNUC30630 zone)

EMBL: CP001515.PE181

CP001515.PE181       Location/Qualifiers
FT   CDS             complement(216519..217229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45579"
FT                   /protein_id="ACS45579.1"
FT                   /translation="MAQHDNTNTEIIRPQGGSQTQAAADTAQIAHTQADAPTQPQGYAF
FT                   DFAQQQGEQIPPSQGYAPQNGEQPFTTAANTAQPNMGGNGVPNNPQGGQMPMNGGAPGN
FT                   RGTATLRGKPGGKTIGIIAAISLGCGLVAGIAGTAVTNAIYRSNEPSHSNMMMRGIGDR
FT                   GFGEGDGDGESMPDFGSGNGSRNRRSYRADGQMPGMQDSDGANGESNGDARNRSQSNDS
FT                   DSNADSGSSDSSKN"
     MAQHDNTNTE IIRPQGGSQT QAAADTAQIA HTQADAPTQP QGYAFDFAQQ QGEQIPPSQG        60
     YAPQNGEQPF TTAANTAQPN MGGNGVPNNP QGGQMPMNGG APGNRGTATL RGKPGGKTIG       120
     IIAAISLGCG LVAGIAGTAV TNAIYRSNEP SHSNMMMRGI GDRGFGEGDG DGESMPDFGS       180
     GNGSRNRRSY RADGQMPGMQ DSDGANGESN GDARNRSQSN DSDSNADSGS SDSSKN           236
//

If you have problems or comments...

PBIL Back to PBIL home page