(data stored in ACNUC30630 zone)

EMBL: CP001515.PE187

CP001515.PE187       Location/Qualifiers
FT   CDS             223760..225586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0192"
FT                   /product="protein-PII uridylyltransferase"
FT                   /note="COG2844 UTP:GlnB (protein PII uridylyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45585"
FT                   /protein_id="ACS45585.1"
FT                   /translation="MAMSTLKQQFLELSEPDADGVYRNGSAKRMARTNLAMRELEALWN
FT                   EAVHSVPFQIPDSGIGLAAVGSLARGQIGPASDLDLVLITADHVALSTTQLNEFANKLW
FT                   YPIWDSGLDLDHSVRTVSRCESVTDHDLPAAMGWLNVNPIAGDRHLIETTATAILERWR
FT                   KAARKRLPELLESANVRNERFDRMSYVNQPDIKESRGGLRDTVLLSALAASWLADRPHG
FT                   RYDDAVERLLDVRDAIHLITRKDADRLLTQYQAEVAAMLGLTDPTLPEGEREAKSIDDL
FT                   QTLLASLSRTIAFALDSTASRAQRTLVHDKPRFSFFQILSPRAGGKREAPKFEMLAPGV
FT                   AKHEQEIVLAPQADPLADPALPLRVAAAAGREGLPINTSTLVNLKRAPIHDKAWSDEMR
FT                   RLFVELLASGERLPQVWEELDFVGIPGRLMPEWDAIRNRPSVSAAHRYTIDRHMLAVTA
FT                   QLGRERPVNGGAFDDVHYTALLLAGILHDIGKRPGVADHAAEGARHAAVIVRRMGFDDQ
FT                   MVDWVRLLVREHLTLSDFASSRNPNDPEVGAELASLVDGDPQLLDMLFALTKADMSSLG
FT                   ATAGETISNTVGWSKWRARLVTQMAALARASM"
     MAMSTLKQQF LELSEPDADG VYRNGSAKRM ARTNLAMREL EALWNEAVHS VPFQIPDSGI        60
     GLAAVGSLAR GQIGPASDLD LVLITADHVA LSTTQLNEFA NKLWYPIWDS GLDLDHSVRT       120
     VSRCESVTDH DLPAAMGWLN VNPIAGDRHL IETTATAILE RWRKAARKRL PELLESANVR       180
     NERFDRMSYV NQPDIKESRG GLRDTVLLSA LAASWLADRP HGRYDDAVER LLDVRDAIHL       240
     ITRKDADRLL TQYQAEVAAM LGLTDPTLPE GEREAKSIDD LQTLLASLSR TIAFALDSTA       300
     SRAQRTLVHD KPRFSFFQIL SPRAGGKREA PKFEMLAPGV AKHEQEIVLA PQADPLADPA       360
     LPLRVAAAAG REGLPINTST LVNLKRAPIH DKAWSDEMRR LFVELLASGE RLPQVWEELD       420
     FVGIPGRLMP EWDAIRNRPS VSAAHRYTID RHMLAVTAQL GRERPVNGGA FDDVHYTALL       480
     LAGILHDIGK RPGVADHAAE GARHAAVIVR RMGFDDQMVD WVRLLVREHL TLSDFASSRN       540
     PNDPEVGAEL ASLVDGDPQL LDMLFALTKA DMSSLGATAG ETISNTVGWS KWRARLVTQM       600
     AALARASM                                                                608
//

If you have problems or comments...

PBIL Back to PBIL home page