(data stored in ACNUC30630 zone)

EMBL: CP001515.PE20

CP001515.PE20        Location/Qualifiers
FT   CDS             23538..26039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0022"
FT                   /product="ABC transporter related protein"
FT                   /note="COG0178 Excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45418"
FT                   /protein_id="ACS45418.1"
FT                   /translation="MAQTIDITGARVHNLKRVDVRVPIGKMVAVAGVSGSGKSSLALGV
FT                   LYAEGSRRYLEGLSTYTRRRISQSGEAKLDAIEHVPPALALHQRPSVPGIRSTFGTMSE
FT                   LLNSLRLMTSRLGNYTCPNGHMLDPTPNVALERPIICPVCGEEVQALGAEDLAFNSGGA
FT                   CPTCSGTGIVRTVNQATLIADPNLTIEQGAVAPWRSLMWSIMVDVCREMGVRTDVPYKD
FT                   LTAHEKEIVLHGPAEKRHIIYHSKKENRAGELDFTYFSAERTVLNALDKAKDAKALKRV
FT                   EPFITEEPCPDCHGTRLNKRARILPVDGKTLPEQCAMQLDNLAQWVRTVPATMPDDMHE
FT                   MAQSIVDEFTRTARRLLELGLGYLTLDRAGSTLSTGERQRIQLARAVRSELTGAMYVLD
FT                   EPSIGLHPANVDGLLGVMRDLKAQGNTVVVVDHDTRVLRDTDWIIEMGPGAGSHGGTVI
FT                   AQGTVSDIEGNPHSLIAPFLASERLQIVRPQTPANKVFDEGALEIKTAPLHTVHALDAR
FT                   VPKHRLTVVTGVSGSGKTTLVLESLVPALTAKIAGERLPEHVRALDAPGIDRVTMIDAT
FT                   PIGANVRSTVATYSGVLDDLRRLYARTDAAKARGLKAGAFSYNTGSLRCPTCDGTGQIT
FT                   LDVQFLPDVDIDCPDCHGTRYGDVAGEITWTPKNGHKPVSLPDLLAMTVDEALDIFTGT
FT                   GQRRLHAELETLHELGIGYLTLGESTPALSGGEAQRLKLASEMGRAQDGTLFVFDEPTI
FT                   GLHPLDVRTLIGVFQKLIDHGASVVVIEHDLDMIANADWIIDMGPGGGENGGEIVATGT
FT                   PVQIAENPLSVTGRYLKPCVE"
     MAQTIDITGA RVHNLKRVDV RVPIGKMVAV AGVSGSGKSS LALGVLYAEG SRRYLEGLST        60
     YTRRRISQSG EAKLDAIEHV PPALALHQRP SVPGIRSTFG TMSELLNSLR LMTSRLGNYT       120
     CPNGHMLDPT PNVALERPII CPVCGEEVQA LGAEDLAFNS GGACPTCSGT GIVRTVNQAT       180
     LIADPNLTIE QGAVAPWRSL MWSIMVDVCR EMGVRTDVPY KDLTAHEKEI VLHGPAEKRH       240
     IIYHSKKENR AGELDFTYFS AERTVLNALD KAKDAKALKR VEPFITEEPC PDCHGTRLNK       300
     RARILPVDGK TLPEQCAMQL DNLAQWVRTV PATMPDDMHE MAQSIVDEFT RTARRLLELG       360
     LGYLTLDRAG STLSTGERQR IQLARAVRSE LTGAMYVLDE PSIGLHPANV DGLLGVMRDL       420
     KAQGNTVVVV DHDTRVLRDT DWIIEMGPGA GSHGGTVIAQ GTVSDIEGNP HSLIAPFLAS       480
     ERLQIVRPQT PANKVFDEGA LEIKTAPLHT VHALDARVPK HRLTVVTGVS GSGKTTLVLE       540
     SLVPALTAKI AGERLPEHVR ALDAPGIDRV TMIDATPIGA NVRSTVATYS GVLDDLRRLY       600
     ARTDAAKARG LKAGAFSYNT GSLRCPTCDG TGQITLDVQF LPDVDIDCPD CHGTRYGDVA       660
     GEITWTPKNG HKPVSLPDLL AMTVDEALDI FTGTGQRRLH AELETLHELG IGYLTLGEST       720
     PALSGGEAQR LKLASEMGRA QDGTLFVFDE PTIGLHPLDV RTLIGVFQKL IDHGASVVVI       780
     EHDLDMIANA DWIIDMGPGG GENGGEIVAT GTPVQIAENP LSVTGRYLKP CVE              833
//

If you have problems or comments...

PBIL Back to PBIL home page