(data stored in ACNUC30630 zone)

EMBL: CP001515.PE201

CP001515.PE201       Location/Qualifiers
FT   CDS             242361..243095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0206"
FT                   /product="Flp pilus assembly protein"
FT                   /note="COG4965 Flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45599"
FT                   /protein_id="ACS45599.1"
FT                   /translation="MAFVAALAAALSVLLMIWAAPAAVSWRLQTVESGVADHACEPACG
FT                   ISVMLSSIIASLQAGAALEPALERAFDSVFPERRCGGARARHMRDPTTSGDGHAVGVYA
FT                   VCDGEGNVDVTQMARLFAACRLPHERASHCAQVACGVAVASAVSLELGCPAARCLEAVR
FT                   AGYLRARLQDDLRANAFAMPKSTARMLLALPAVVVFLGELLGADPLGMLFGSAQGRAML
FT                   CLGTICYVGGLLWMQRLLAADG"
     MAFVAALAAA LSVLLMIWAA PAAVSWRLQT VESGVADHAC EPACGISVML SSIIASLQAG        60
     AALEPALERA FDSVFPERRC GGARARHMRD PTTSGDGHAV GVYAVCDGEG NVDVTQMARL       120
     FAACRLPHER ASHCAQVACG VAVASAVSLE LGCPAARCLE AVRAGYLRAR LQDDLRANAF       180
     AMPKSTARML LALPAVVVFL GELLGADPLG MLFGSAQGRA MLCLGTICYV GGLLWMQRLL       240
     AADG                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page