(data stored in ACNUC30630 zone)

EMBL: CP001515.PE217

CP001515.PE217       Location/Qualifiers
FT   CDS             263931..264551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0222"
FT                   /product="Thymidylate kinase"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45615"
FT                   /protein_id="ACS45615.1"
FT                   /translation="MGAGLFISFEGVDGAGKTTQVNLLADYLRALGREVVVTREPGGTA
FT                   LGTQIRAMLLTTNPDEEISPRTEALLFAADRAQHVSEVIRPALERGAVVITDRYLDSSL
FT                   AYQSGGRELTADDIRTLSMWATNNLLPARTYLLDIDPRASHTRLEHAEDRMESAGDDFQ
FT                   QRTRTAFLELAAVQPQRFCVIDAQQSVGEIAALICDDVANLLE"
     MGAGLFISFE GVDGAGKTTQ VNLLADYLRA LGREVVVTRE PGGTALGTQI RAMLLTTNPD        60
     EEISPRTEAL LFAADRAQHV SEVIRPALER GAVVITDRYL DSSLAYQSGG RELTADDIRT       120
     LSMWATNNLL PARTYLLDID PRASHTRLEH AEDRMESAGD DFQQRTRTAF LELAAVQPQR       180
     FCVIDAQQSV GEIAALICDD VANLLE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page