(data stored in ACNUC30630 zone)

EMBL: CP001515.PE218

CP001515.PE218       Location/Qualifiers
FT   CDS             264557..265849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0223"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45616"
FT                   /protein_id="ACS45616.1"
FT                   /translation="MSVWDAIVGQPKVVEELRRVAEGDGRGVAQSWLICGPAGSGTMQV
FT                   ARAFAAALESPDHGEGELPTKITSQILADRFPDVVTLSTDKVTIGIDEVRDLVTLSEQM
FT                   PSTAPWRIIIIENTERMLERTTNVLLKEIEEPSAHTIWLLCAPSAQDVLPTIRSRTRLV
FT                   TLGVPVADEIATWLEREVRVLEDPTKRERARAKAVGGRAGAKAARSGKSAKAPKPAPAP
FT                   EPRPVSHETAVRIARLCEGNLDIARLYARYPSVLRSRDQLVNNVLKMTRASQAVVFAGE
FT                   LYGSAQEQANERAEQAAGERQAEFRKLNGLSPDETVPADLRRAYTALAKKDDIKRHATR
FT                   MTRDVLDRAFTTIASIYRDVAVFQNDAEGSVGLINIENRDAIAELSAQLTREQTLARMD
FT                   AISTARRRIAGNGNALLDIEALFCALLPERR"
     MSVWDAIVGQ PKVVEELRRV AEGDGRGVAQ SWLICGPAGS GTMQVARAFA AALESPDHGE        60
     GELPTKITSQ ILADRFPDVV TLSTDKVTIG IDEVRDLVTL SEQMPSTAPW RIIIIENTER       120
     MLERTTNVLL KEIEEPSAHT IWLLCAPSAQ DVLPTIRSRT RLVTLGVPVA DEIATWLERE       180
     VRVLEDPTKR ERARAKAVGG RAGAKAARSG KSAKAPKPAP APEPRPVSHE TAVRIARLCE       240
     GNLDIARLYA RYPSVLRSRD QLVNNVLKMT RASQAVVFAG ELYGSAQEQA NERAEQAAGE       300
     RQAEFRKLNG LSPDETVPAD LRRAYTALAK KDDIKRHATR MTRDVLDRAF TTIASIYRDV       360
     AVFQNDAEGS VGLINIENRD AIAELSAQLT REQTLARMDA ISTARRRIAG NGNALLDIEA       420
     LFCALLPERR                                                              430
//

If you have problems or comments...

PBIL Back to PBIL home page