(data stored in ACNUC30630 zone)

EMBL: CP001515.PE22

CP001515.PE22        Location/Qualifiers
FT   CDS             27202..28116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45420"
FT                   /protein_id="ACS45420.1"
FT                   /translation="MAEYSGSSGYAEYEYLGTANGTSFAKRHPYLLWQIIGWSILLADA
FT                   VFFVVAALQDFGEWCYPVIVFPFIAALFAVIGSPFLIYFSRKAKIPQAASKREASVVRS
FT                   HITMISQIRGESHPVLMALLIIALALGLLVLTLQLGMRGYILPGFLAMVAMVVVPFVVY
FT                   AQYSAAQRKRFMAVPDAAYLVGVHYADQSRYESVELRETDALMMPVPAKPSTAMLDFVY
FT                   NWLREYLATDWLTVTVLSFDDLLRSGVVVNDSDTEDTDPTASFPLIPARQFNLDGDARA
FT                   QLDEESKAIGAFWLSRWRGYTQM"
     MAEYSGSSGY AEYEYLGTAN GTSFAKRHPY LLWQIIGWSI LLADAVFFVV AALQDFGEWC        60
     YPVIVFPFIA ALFAVIGSPF LIYFSRKAKI PQAASKREAS VVRSHITMIS QIRGESHPVL       120
     MALLIIALAL GLLVLTLQLG MRGYILPGFL AMVAMVVVPF VVYAQYSAAQ RKRFMAVPDA       180
     AYLVGVHYAD QSRYESVELR ETDALMMPVP AKPSTAMLDF VYNWLREYLA TDWLTVTVLS       240
     FDDLLRSGVV VNDSDTEDTD PTASFPLIPA RQFNLDGDAR AQLDEESKAI GAFWLSRWRG       300
     YTQM                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page