(data stored in ACNUC30630 zone)

EMBL: CP001515.PE25

CP001515.PE25        Location/Qualifiers
FT   CDS             30678..30914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0027"
FT                   /product="hypothetical protein"
FT                   /note="COG1198 Primosomal protein N (replication factor Y -
FT                   superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45423"
FT                   /protein_id="ACS45423.1"
FT                   /translation="MANMGDYADMDAENVESAEVVCPRCGSRHVAQILHGMPAFTEELQ
FT                   RELAEGKVVLGGCDIDIFHPTPSYHCNDCEEEF"
     MANMGDYADM DAENVESAEV VCPRCGSRHV AQILHGMPAF TEELQRELAE GKVVLGGCDI        60
     DIFHPTPSYH CNDCEEEF                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page