(data stored in ACNUC30630 zone)

EMBL: CP001515.PE250

CP001515.PE250       Location/Qualifiers
FT   CDS             310344..311996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0257"
FT                   /product="hypothetical protein"
FT                   /note="COG0457 FOG: TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45648"
FT                   /protein_id="ACS45648.1"
FT                   /translation="MAEQESALDFIEATHLWSQHAQFVGRAEGAPNPFRTIYGVEAQPG
FT                   GVWDVMTRFHTICERLQLPFHVSTSVEVNPATGDMAVAFGAPEPTQFPTAVPDSHGRAR
FT                   DCTGKRAQWTAAYALRLAALLANIGFAVNTGIIGVTVIARAGEPDGQTLFSLGFNRVDF
FT                   HFTTAKLFADGTIDDAQFDVDPAQLLAAFDVDSARVEFDADGWFAPTEDPELPESLCEL
FT                   RTPLGEDARELPDSLKSLLRADRVCDLDIADQASLSIRDIHQIAQENADSPVTAVVELG
FT                   GALTTLKQELSVSTSIRQPLYCEREALRLLVSEAAGDAATRYRTVPGAIAAVRSELARF
FT                   DMKLGQLDDALRELQELQRISPTSVQGGIAEAMAYSMAGDTARAVDAIRQALKLAVVPD
FT                   EVAFLYCLLGQMFAMAGETDTAIDAYYVASTVAAQTAYTGVARQAMEALLAQIGSADDD
FT                   GERDERSFTATVDARPTAPSRGHALGSLQAAGIPISPTQPVIQTLTRAAMLLADAGVPL
FT                   AAYDGVEILAEYSAEPTLLWMCRALQEGAGCAR"
     MAEQESALDF IEATHLWSQH AQFVGRAEGA PNPFRTIYGV EAQPGGVWDV MTRFHTICER        60
     LQLPFHVSTS VEVNPATGDM AVAFGAPEPT QFPTAVPDSH GRARDCTGKR AQWTAAYALR       120
     LAALLANIGF AVNTGIIGVT VIARAGEPDG QTLFSLGFNR VDFHFTTAKL FADGTIDDAQ       180
     FDVDPAQLLA AFDVDSARVE FDADGWFAPT EDPELPESLC ELRTPLGEDA RELPDSLKSL       240
     LRADRVCDLD IADQASLSIR DIHQIAQENA DSPVTAVVEL GGALTTLKQE LSVSTSIRQP       300
     LYCEREALRL LVSEAAGDAA TRYRTVPGAI AAVRSELARF DMKLGQLDDA LRELQELQRI       360
     SPTSVQGGIA EAMAYSMAGD TARAVDAIRQ ALKLAVVPDE VAFLYCLLGQ MFAMAGETDT       420
     AIDAYYVAST VAAQTAYTGV ARQAMEALLA QIGSADDDGE RDERSFTATV DARPTAPSRG       480
     HALGSLQAAG IPISPTQPVI QTLTRAAMLL ADAGVPLAAY DGVEILAEYS AEPTLLWMCR       540
     ALQEGAGCAR                                                              550
//

If you have problems or comments...

PBIL Back to PBIL home page