(data stored in ACNUC30630 zone)

EMBL: CP001515.PE272

CP001515.PE272       Location/Qualifiers
FT   CDS             complement(346937..347533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0279"
FT                   /product="Putative metal-binding/nucleic acid-binding
FT                   protein"
FT                   /note="COG1399 Predicted metal-binding, possibly nucleic
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45670"
FT                   /protein_id="ACS45670.1"
FT                   /translation="MARIEYTDWTVPVAQVGSRAGQTMQVDRDFPAPGGIGDSIVGVKE
FT                   GEPIHVNGQFDSIIDGLIFTGTFTAPVTAVCARCDRDLSGDWSEQVTAFFPYEDADAGK
FT                   TKNEDVEIIAGEEESGDTYPLIDNGAFANIEPLLRDTFVSALPLNPLCKPDCKGLCPQC
FT                   GLDLNESPEHVHEVTDLRFADLEALKEQLEREQGE"
     MARIEYTDWT VPVAQVGSRA GQTMQVDRDF PAPGGIGDSI VGVKEGEPIH VNGQFDSIID        60
     GLIFTGTFTA PVTAVCARCD RDLSGDWSEQ VTAFFPYEDA DAGKTKNEDV EIIAGEEESG       120
     DTYPLIDNGA FANIEPLLRD TFVSALPLNP LCKPDCKGLC PQCGLDLNES PEHVHEVTDL       180
     RFADLEALKE QLEREQGE                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page