(data stored in ACNUC30630 zone)

EMBL: CP001515.PE28

CP001515.PE28        Location/Qualifiers
FT   CDS             complement(31962..32285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0030"
FT                   /product="MazG nucleotide pyrophosphohydrolase domain
FT                   protein"
FT                   /note="COG1694 Predicted pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45426"
FT                   /protein_id="ACS45426.1"
FT                   /translation="MISDDTLRMIHQFSADRDWQQFHAPANMAKSVSIEAGELLECFQW
FT                   SDEPRDGDWEHVYEELADVMIYCIQMADVLDVDLDEIIRSKMAKNAKKYPVEASRGSSA
FT                   KAE"
     MISDDTLRMI HQFSADRDWQ QFHAPANMAK SVSIEAGELL ECFQWSDEPR DGDWEHVYEE        60
     LADVMIYCIQ MADVLDVDLD EIIRSKMAKN AKKYPVEASR GSSAKAE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page