(data stored in ACNUC30630 zone)

EMBL: CP001515.PE289

CP001515.PE289       Location/Qualifiers
FT   CDS             364034..365458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balac_0298"
FT                   /product="Permease component of hypothetical
FT                   ABC-typetransport system"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Balac_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS45687"
FT                   /protein_id="ACS45687.1"
FT                   /translation="MSTFALWRLFHRHMFHHDDEPDAPRDHTGLLAVIAFAAATAIFLT
FT                   VLGGLHGFIWRASPDHTVGCFFNDSACSTHANVSVNGEFYVVLAMFACVLLVVPFTTLA
FT                   GSAARLAATRRDERLAVLRLAGATTSQVVRLIALEAVGQAVIGSVLGIAGYFAVMPLIM
FT                   MLHFENHTFDFEQLWVGPWALIGTVVGVAALALVSALLTLRKVAITPLGVTARQGAAMP
FT                   GKWRVALFVVALVFGFAMLNNMNLVAGAGVAVAYGVVFAIIGGCFMLLNVIGSWVIAAV
FT                   AKSRAHRPKSAATMIAMRRILDNPKRAWRNVSGIALAVFIAGITAVCGALGTASGDADA
FT                   ETLMMMHDISLGGTLTLVFAAVLAAVSSGIMQSASVFDQADEYHMLMLEGTDALTLRKA
FT                   RFSEVLTPLNTVIVISAGCSLLLMLPLVGSMLSNPAVLLRCLFGIVLCYALVTVGAVSA
FT                   NHTATRLDSISRRRDD"
     MSTFALWRLF HRHMFHHDDE PDAPRDHTGL LAVIAFAAAT AIFLTVLGGL HGFIWRASPD        60
     HTVGCFFNDS ACSTHANVSV NGEFYVVLAM FACVLLVVPF TTLAGSAARL AATRRDERLA       120
     VLRLAGATTS QVVRLIALEA VGQAVIGSVL GIAGYFAVMP LIMMLHFENH TFDFEQLWVG       180
     PWALIGTVVG VAALALVSAL LTLRKVAITP LGVTARQGAA MPGKWRVALF VVALVFGFAM       240
     LNNMNLVAGA GVAVAYGVVF AIIGGCFMLL NVIGSWVIAA VAKSRAHRPK SAATMIAMRR       300
     ILDNPKRAWR NVSGIALAVF IAGITAVCGA LGTASGDADA ETLMMMHDIS LGGTLTLVFA       360
     AVLAAVSSGI MQSASVFDQA DEYHMLMLEG TDALTLRKAR FSEVLTPLNT VIVISAGCSL       420
     LLMLPLVGSM LSNPAVLLRC LFGIVLCYAL VTVGAVSANH TATRLDSISR RRDD             474
//

If you have problems or comments...

PBIL Back to PBIL home page